PDB entry 3n4q

View 3n4q on RCSB PDB site
Description: Human cytomegalovirus terminase nuclease domain, Mn soaked
Deposited on 2010-05-22, released 2010-10-13
The last revision was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.211
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: terminase subunit ul89 protein
    Species: Human herpesvirus 5 [TaxId:10363]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: terminase subunit ul89 protein
    Species: Human herpesvirus 5 [TaxId:10363]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: terminase subunit ul89 protein
    Species: Human herpesvirus 5 [TaxId:10363]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: terminase subunit ul89 protein
    Species: Human herpesvirus 5 [TaxId:10363]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4qA (A:)
    mghhhhhhdydipttenlyfqgggtnkisqntvlitdqsreefdilrystlntnaydyfg
    ktlyvyldpafttnrkasgtgvaavgayrhqfliyglehfflrdlsessevaiaecaahm
    iisvlslhpyldelriavegntnqaaavriaclirqsvqsstlirvlfyhtpdqnhieqp
    fylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpieylleqiqnlhrvtlaeg
    ttarysakrqnrisddliiavimatylcddihairfrvs
    

    Sequence, based on observed residues (ATOM records):
    >3n4qA (A:)
    litdqsreefdilrystlntnaydyfgktlyvyldpagtgvaavgayrhqfliyglehff
    lsessevaiaecaahmiisvlslhpyldelriavegntnqaaavriaclirqsvqsstli
    rvlfyhtpdqnhieqpfylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpiey
    lleqiqnlhrsddliiavimatylcddihairfrvs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4qB (B:)
    mghhhhhhdydipttenlyfqgggtnkisqntvlitdqsreefdilrystlntnaydyfg
    ktlyvyldpafttnrkasgtgvaavgayrhqfliyglehfflrdlsessevaiaecaahm
    iisvlslhpyldelriavegntnqaaavriaclirqsvqsstlirvlfyhtpdqnhieqp
    fylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpieylleqiqnlhrvtlaeg
    ttarysakrqnrisddliiavimatylcddihairfrvs
    

    Sequence, based on observed residues (ATOM records):
    >3n4qB (B:)
    litdqsreefdilrystlntnaydyfgktlyvyldpaasgtgvaavgayrhqfliygleh
    fflessevaiaecaahmiisvlslhpyldelriavegntnqaaavriaclirqsvqsstl
    irvlfyhtpdqnhieqpfylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpie
    ylleqiqnlhrvnrisddliiavimatylcddihairfrvs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n4qC (C:)
    mghhhhhhdydipttenlyfqgggtnkisqntvlitdqsreefdilrystlntnaydyfg
    ktlyvyldpafttnrkasgtgvaavgayrhqfliyglehfflrdlsessevaiaecaahm
    iisvlslhpyldelriavegntnqaaavriaclirqsvqsstlirvlfyhtpdqnhieqp
    fylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpieylleqiqnlhrvtlaeg
    ttarysakrqnrisddliiavimatylcddihairfrvs
    

    Sequence, based on observed residues (ATOM records):
    >3n4qC (C:)
    litdqsreefdilrystlntnaydyfgktlyvyldpaasgtgvaavgayrhqfliygleh
    fflrdlsessevaiaecaahmiisvlslhpyldelriavegntnqaaavriaclirqsvq
    sstlirvlfyhtpdqnhieqpfylmgrdkalaveqfisrfnsgyikasqelvsytiklsh
    dpieylleqiqnlisddliiavimatylcddihairfrv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n4qD (D:)
    mghhhhhhdydipttenlyfqgggtnkisqntvlitdqsreefdilrystlntnaydyfg
    ktlyvyldpafttnrkasgtgvaavgayrhqfliyglehfflrdlsessevaiaecaahm
    iisvlslhpyldelriavegntnqaaavriaclirqsvqsstlirvlfyhtpdqnhieqp
    fylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpieylleqiqnlhrvtlaeg
    ttarysakrqnrisddliiavimatylcddihairfrvs
    

    Sequence, based on observed residues (ATOM records):
    >3n4qD (D:)
    litdqsreefdilrystlntnaydyfgktlyvyldpasgtgvaavgayrhqfliyglehf
    fessevaiaecaahmiisvlslhpyldelriavegntnqaaavriaclirqsvqsstlir
    vlfyhtpdqnhieqpfylmgrdkalaveqfisrfnsgyikasqelvsytiklshdpieyl
    leqiqnlhrddliiavimatylcddihairfrvs