PDB entry 3n4k

View 3n4k on RCSB PDB site
Description: Putative RNA methyltransferase from Yersinia pestis in complex with S-ADENOSYL-L-HOMOCYSTEINE.
Class: transferase
Keywords: RNA methyltransferase, S-ADENOSYL-L-HOMOCYSTEINE, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2010-05-21, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA methyltransferase
    Species: Yersinia pestis [TaxId:214092]
    Gene: cspR, YPO0071, YP_0071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74Y93 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3n4ka1, d3n4ka2
  • Chain 'B':
    Compound: RNA methyltransferase
    Species: Yersinia pestis [TaxId:214092]
    Gene: cspR, YPO0071, YP_0071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74Y93 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3n4kb1, d3n4kb2
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n4kA (A:)
    snamlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadi
    khhhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayild
    alpaqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgallke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n4kA (A:)
    namlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadik
    hhhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayilda
    lpaqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgallk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n4kB (B:)
    snamlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadi
    khhhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayild
    alpaqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgallke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n4kB (B:)
    namlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadik
    hhhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayilda
    lpaqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgal