PDB entry 3n4j

View 3n4j on RCSB PDB site
Description: Putative RNA methyltransferase from Yersinia pestis
Class: transferase
Keywords: RNA methyltransferase, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2010-05-21, released 2010-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA methyltransferase
    Species: Yersinia pestis [TaxId:214092]
    Gene: cspR, YPO0071, YP_0071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74Y93 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d3n4ja1, d3n4ja2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3n4jA (A:)
snamlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadi
khhhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayild
alpaqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgallke

    Sequence, based on observed residues (ATOM records): (download) 
    >3n4jA (A:)
amlnivlfepeippntgniirlcantgcqlhlikplgftwddkrlrragldyhefadikh
hhdyqafldsekldstqparlfalttkgtpahsavsyqandyllfgpetrglpayildal
paqqkiripmqadsrsmnlsnavsvvvyeawrqlgypgall