PDB entry 3n4h

View 3n4h on RCSB PDB site
Description: crystal structure of cg10062 inactivated by (s)-oxirane-2-carboxylate
Deposited on 2010-05-21, released 2011-06-01
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tautomerase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0081, Cg10062, Cgl0062
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4hA (A:)
    xtytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltelegsse
    

    Sequence, based on observed residues (ATOM records):
    >3n4hA (A:)
    xtytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrl