PDB entry 3n4g

View 3n4g on RCSB PDB site
Description: crystal structure of native cg10062
Deposited on 2010-05-21, released 2011-06-01
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tautomerase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0081, Cg10062, Cgl0062
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative tautomerase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0081, Cg10062, Cgl0062
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative tautomerase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: cg0081, Cg10062, Cgl0062
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4gA (A:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltelegsse
    

    Sequence, based on observed residues (ATOM records):
    >3n4gA (A:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltelegs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4gB (B:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltelegsse
    

    Sequence, based on observed residues (ATOM records):
    >3n4gB (B:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltel
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n4gC (C:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltelegsse
    

    Sequence, based on observed residues (ATOM records):
    >3n4gC (C:)
    ptytcwsqririsreakqriaeaitdahhelahapkylvqvifnevepdsyfiaaqsase
    nhiwvqatirsgrtekqkeelllrltqeialilgipneevwvyiteipgsnmteygrllm
    epgeeekwfnslpeglrerltel