PDB entry 3n4f

View 3n4f on RCSB PDB site
Description: crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10
Deposited on 2010-05-21, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Geobacillus sp. [TaxId:481743]
    Gene: 192811615, GYMC10_3367
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3EID5 (3-383)
      • expression tag (1-2)
      • expression tag (384-390)
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Geobacillus sp. [TaxId:481743]
    Gene: 192811615, GYMC10_3367
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3EID5 (3-383)
      • expression tag (384-388)
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Geobacillus sp. [TaxId:481743]
    Gene: 192811615, GYMC10_3367
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3EID5 (3-383)
      • expression tag (384-388)
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Geobacillus sp. [TaxId:481743]
    Gene: 192811615, GYMC10_3367
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3EID5 (Start-383)
      • expression tag (384-385)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4fA (A:)
    mslnitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygs
    sihmtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahl
    etgaslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmpl
    wegtkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhede
    alyedlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgek
    ldahglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvp
    atpgfgivfddelvtylinrsgwseghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4fA (A:)
    slnitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygss
    ihmtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahle
    tgaslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmplw
    egtkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhedea
    lyedlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgekl
    dahglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvpa
    tpgfgivfddelvtylinrsgwseghhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4fB (B:)
    mslnitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygs
    sihmtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahl
    etgaslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmpl
    wegtkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhede
    alyedlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgek
    ldahglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvp
    atpgfgivfddelvtylinrsgwseghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4fB (B:)
    nitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygssih
    mtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahletg
    aslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmplweg
    tkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhedealy
    edlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgeklda
    hglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvpatp
    gfgivfddelvtylinrsgwseghhh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n4fC (C:)
    mslnitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygs
    sihmtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahl
    etgaslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmpl
    wegtkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhede
    alyedlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgek
    ldahglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvp
    atpgfgivfddelvtylinrsgwseghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4fC (C:)
    nitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygssih
    mtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahletg
    aslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmplweg
    tkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhedealy
    edlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgeklda
    hglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvpatp
    gfgivfddelvtylinrsgwseghhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n4fD (D:)
    mslnitgiqsdwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygs
    sihmtpewaedvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahl
    etgaslvvpcydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmpl
    wegtkrdiaivrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhede
    alyedlkewlgqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgek
    ldahglrsaphcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvp
    atpgfgivfddelvtylinrsgwseghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4fD (D:)
    dwkvekiefakltgerarsagangrigvhgksctvdiaritidgqtgygssihmtpewae
    dvigrrlldlfddrgrlreayrlqleypvldwlgqrqgkpvydlvsgahletgaslvvpc
    ydtslyfddlhladeraavalmqeeamqgyakgqrhfkikvgrggrhmplwegtkrdiai
    vrgisevagpagkimidannaynlnltkevlaalsdvnlywleeafhedealyedlkewl
    gqrgqnvliadgeglasphliewatrgrvdvlqydiiwpgfthwmelgekldahglrsap
    hcygnaygiyasghlsaavrnfefveydditiegmdvsgyriengeihvpatpgfgivfd
    delvtylinrsgwseg