PDB entry 3n4e

View 3n4e on RCSB PDB site
Description: crystal structure of mandelate racemase/muconate lactonizing protein from paracoccus denitrificans pd1222
Deposited on 2010-05-21, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: 69934097, Pden_0244
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1AYL4 (3-End)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: 69934097, Pden_0244
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1AYL4 (3-End)
      • expression tag (1-2)
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n4eA (A:)
    mslkiakvealsvamgdgtgwmptsafvritaedgtvgwgeaspmlggiaslgvvardia
    pflegqevldhavlldrmmhrlvklgpegiataalaacdialwdlkgkllgqpiykllgg
    awrtrlpcyssiggnaarsvdevvrevarrveaeqpaavkirwdgdrtrcdvdipgdiak
    aravrellgpdavigfdanngysvggairvgraledlgyswfeepvqhyhvgamgevaqr
    lditvsageqtytlqalkdlilsgvrmvqpdivkmggitgmmqcaalahahgvefvphqt
    qpgvghfanihvlstlmhmtkpveladrwdrgrpvfrnpaepvdghfalgdapglgivvd
    edelasrateitvgrdqrppaggqyeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4eA (A:)
    slkiakvealsvamgptsafvritaedgtvgwgeaspmlggiaslgvvardiapflegqe
    vldhavlldrmmhrlvklgpegiataalaacdialwdlkgkllgqpiykllggawrtrlp
    cyssiggnaarsvdevvrevarrveaeqpaavkirwdgdrtrcdvdipgdiakaravrel
    lgpdavigfdanngysvggairvgraledlgyswfeepvqhyhvgamgevaqrlditvsa
    geqtytlqalkdlilsgvrmvqpdivkmggitgmmqcaalahahgvefvphqtqpgvghf
    anihvlstlmhmtkpveladrwdrgrpvfrnpaepvdghfalgdapglgivvdedelasr
    ateitvgr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n4eB (B:)
    mslkiakvealsvamgdgtgwmptsafvritaedgtvgwgeaspmlggiaslgvvardia
    pflegqevldhavlldrmmhrlvklgpegiataalaacdialwdlkgkllgqpiykllgg
    awrtrlpcyssiggnaarsvdevvrevarrveaeqpaavkirwdgdrtrcdvdipgdiak
    aravrellgpdavigfdanngysvggairvgraledlgyswfeepvqhyhvgamgevaqr
    lditvsageqtytlqalkdlilsgvrmvqpdivkmggitgmmqcaalahahgvefvphqt
    qpgvghfanihvlstlmhmtkpveladrwdrgrpvfrnpaepvdghfalgdapglgivvd
    edelasrateitvgrdqrppaggqyeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n4eB (B:)
    slkiakvealsvamgptsafvritaedgtvgwgeaspmlggiaslgvvardiapflegqe
    vldhavlldrmmhrlvklgpegiataalaacdialwdlkgkllgqpiykllggawrtrlp
    cyssiggnaarsvdevvrevarrveaeqpaavkirwdgdrtrcdvdipgdiakaravrel
    lgpdavigfdanngysvggairvgraledlgyswfeepvqhyhvgamgevaqrlditvsa
    geqtytlqalkdlilsgvrmvqpdivkmggitgmmqcaalahahgvefvphqtqpgvghf
    anihvlstlmhmtkpveladrwdrgrpvfrnpaepvdghfalgdapglgivvdedelasr
    ateitvg