PDB entry 3n4c

View 3n4c on RCSB PDB site
Description: 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: Cathepsin S, covalent inhibitor, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-21, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.251
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS, Homo sapiens
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n4ca_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS, Homo sapiens
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n4cb_
  • Heterogens: EF3, DMS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n4cA (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n4cB (B:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei