PDB entry 3n49

View 3n49 on RCSB PDB site
Description: Human FPPS COMPLEX WITH NOV_292
Class: transferase/transferase inhibitor
Keywords: BISPHOSPHONATE; FRAGMENT-BASED SCREENING; TRANSFERASE; ISOPRENE BIOSYNTHESIS; CHOLESTEROL BIOSYNTHESIS, RANSFERASE-TRANSFERASE INHIBITOR complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-05-21, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: farnesyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n49f_
  • Heterogens: 3N4, PO4, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n49F (F:)
    gpnsdvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrglt
    vvvafrelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpg
    vgldaindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnv
    dlvrftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqd
    dyldlfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvka
    lyeeldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n49F (F:)
    dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
    frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
    aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
    ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
    lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
    ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk