PDB entry 3n42

View 3n42 on RCSB PDB site
Description: Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of Chikungunya virus.
Class: viral protein
Keywords: viral protein, immature heterodimer, alphavirus, receptor binding, membrane fusion
Deposited on 2010-05-21, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.249
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: e2 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: e1 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1H8W5 (22-414)
      • see remark 999 (20-21)
    Domains in SCOPe 2.07: d3n42f1, d3n42f2, d3n42f3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n42F (F:)
    elyggggsggggsggggsggggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtl
    eptlsldyitceyktvipspyvkccgtaeckdknlpdysckvftgvypfmwggaycfcda
    entqlseahveksescktefasayrahtasasaklrvlyqgnnitvtayangdhavtvkd
    akfivgpmssawtpfdnkivvykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantq
    lvlqrpaagtvhvpysqapsgfkywlkergaslqhtapfgcqiatnpvravncavgnmpi
    sidipeaaftrvvdapsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavt
    ireaeievegnsqlqisfstalasaefrvqvcstqvhcaaechppkdhivnypashttlg
    vqdisatamswvqkgpfeddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n42F (F:)
    ggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipsp
    yvkccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktef
    asayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkiv
    vykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqaps
    gfkywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvdapsltd
    mscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsqlqisfst
    alasaefrvqvcstqvhcaaechppkdhivnypas