PDB entry 3n3z

View 3n3z on RCSB PDB site
Description: Crystal structure of PDE9A (E406A) mutant in complex with IBMX
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-21, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.202
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76083 (0-325)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d3n3za_
  • Chain 'B':
    Compound: High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76083 (0-325)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d3n3zb_
  • Heterogens: IBM, ZN, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n3zA (A:)
    ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
    cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
    ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
    latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnavrpmevaepwvdcl
    leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
    qplwesrdryeelkriddamkelqkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n3zB (B:)
    ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
    cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
    ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
    latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnavrpmevaepwvdcl
    leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
    qplwesrdryeelkriddamkelqkk