PDB entry 3n3y

View 3n3y on RCSB PDB site
Description: crystal structure of thymidylate synthase x (thyx) from helicobacter pylori with fad and dump at 2.31a resolution
Deposited on 2010-05-21, released 2011-05-25
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase thyX
    Species: Helicobacter pylori [TaxId:102617]
    Gene: thyX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UVJ4 (8-215)
      • expression tag (7)
  • Chain 'B':
    Compound: Thymidylate synthase thyX
    Species: Helicobacter pylori [TaxId:102617]
    Gene: thyX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UVJ4 (8-215)
      • expression tag (7)
  • Chain 'C':
    Compound: Thymidylate synthase thyX
    Species: Helicobacter pylori [TaxId:102617]
    Gene: thyX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UVJ4 (8-215)
      • expression tag (7)
  • Chain 'D':
    Compound: Thymidylate synthase thyX
    Species: Helicobacter pylori [TaxId:102617]
    Gene: thyX
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UMP, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n3yA (A:)
    gplgspefmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstl
    ehlyynfeikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnleraref
    lvfvdnekvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnllt
    lrssnkalkemqdlakalfdalpgehqylfedclkh
    

    Sequence, based on observed residues (ATOM records):
    >3n3yA (A:)
    fmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstlehlyynf
    eikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnlerareflvfvdne
    kvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnlltlrssnka
    lkemqdlakalfdalpgehqylfedclkh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n3yB (B:)
    gplgspefmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstl
    ehlyynfeikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnleraref
    lvfvdnekvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnllt
    lrssnkalkemqdlakalfdalpgehqylfedclkh
    

    Sequence, based on observed residues (ATOM records):
    >3n3yB (B:)
    fmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstlehlyynf
    eikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnlerareflvfvdne
    kvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnlltlrssnka
    lkemqdlakalfdalpgehqylfedclkh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n3yC (C:)
    gplgspefmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstl
    ehlyynfeikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnleraref
    lvfvdnekvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnllt
    lrssnkalkemqdlakalfdalpgehqylfedclkh
    

    Sequence, based on observed residues (ATOM records):
    >3n3yC (C:)
    fmevickhytpldiasqairtcwqsfeysdggckdkelihrvgnifrhsstlehlyynfe
    ikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnlerareflvfvdnek
    vnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnlltlrssnkal
    kemqdlakalfdalpgehqylfedclkh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n3yD (D:)
    gplgspefmevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstl
    ehlyynfeikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnleraref
    lvfvdnekvnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnllt
    lrssnkalkemqdlakalfdalpgehqylfedclkh
    

    Sequence, based on observed residues (ATOM records):
    >3n3yD (D:)
    mevickhytpldiasqairtcwqsfeysddggckdkelihrvgnifrhsstlehlyynfe
    ikglsrgalqelsrhriaslsvkssrytlrelkevesflplnetnlerareflvfvdnek
    vnamsvlalenlrvllsehnikndlakyampesykthlaysinarslqnlltlrssnkal
    kemqdlakalfdalpgehqylfedclkh