PDB entry 3n3v

View 3n3v on RCSB PDB site
Description: Crystal Structure of IbpAFic2-H3717A in complex with adenylylated Cdc42
Class: transferase
Keywords: Fic domain in complex with adenylylated Cdc42, TRANSFERASE
Deposited on 2010-05-20, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine monophosphate-protein transferase ibpA
    Species: Histophilus somni [TaxId:228400]
    Gene: HSM_1489, ibpA, p76
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06277 (0-298)
      • engineered mutation (229)
  • Chain 'B':
    Compound: Adenosine monophosphate-protein transferase ibpA
    Species: Histophilus somni [TaxId:228400]
    Gene: HSM_1489, ibpA, p76
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06277 (0-End)
      • engineered mutation (229)
  • Chain 'C':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953
      • variant (162)
    Domains in SCOPe 2.07: d3n3vc_
  • Chain 'D':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953
      • variant (162)
    Domains in SCOPe 2.07: d3n3vd_
  • Heterogens: SO4, AMP, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n3vC (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    etqpkrkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3vC (C:)
    tikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagqe
    dydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrdd
    pstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n3vD (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    etqpkrkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3vD (D:)
    tikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagqe
    dydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrdd
    pstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep