PDB entry 3n3u

View 3n3u on RCSB PDB site
Description: crystal structure of ibpafic2
Deposited on 2010-05-20, released 2010-07-14
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine monophosphate-protein transferase ibpA
    Species: Histophilus somni [TaxId:228400]
    Gene: HSM_1489, ibpA, p76
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n3uA (A:)
    vnyqdlednlnlkglisleddrnanfesnvlknekfldeareiskksipeatvkqmshlp
    efddiltegakkvesrinkaitfrpsveefseiqdlvktlpktkviedlstktneiteal
    aatsktiqrtpelkeqlktaiedflqnsqgkpltvqmienlnhglrpdegegrllykken
    ltkenavfsspeaakiqlaetvdfinraknegiepsvvgalvyqrliayhpfaegngrma
    rvivnkilldagypaftkfsdefepqiipqtkastksatssevvveflkelakkgsked
    

    Sequence, based on observed residues (ATOM records):
    >3n3uA (A:)
    vnyqdlednlnlkglisleddrnanfesnvlknekfldeareiskksipeatvkqmshlp
    efddiltegakkvesrinkaitfrpsveefseiqdlvktlpktkviedlstktneiteal
    aatsktiqrtpelkeqlktaiedflqnsqgkpltvqmienlnhglrpdegegrllykken
    avfsspeaakiqlaetvdfinraknegiepsvvgalvyqrliayhpfaegngrmarvivn
    killdagypaftkfsdefepqiipqtkastksatssevvveflkelakkgs