PDB entry 3n3t

View 3n3t on RCSB PDB site
Description: crystal structure of putative diguanylate cyclase/phosphodiesterase complex with cyclic di-gmp
Deposited on 2010-05-20, released 2010-06-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative diguanylate cyclase/phosphodiesterase
    Species: Thiobacillus denitrificans [TaxId:292415]
    Gene: Tbd_1265
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative diguanylate cyclase/phosphodiesterase
    Species: Thiobacillus denitrificans [TaxId:292415]
    Gene: Tbd_1265
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3SJE6 (22-End)
      • expression tag (21)
  • Heterogens: C2E, MG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n3tA (A:)
    mgsshhhhhhssgrenlyfqgherltldtrlrqalernelvlhyqpivelasgrivggea
    lvrwedperglvmpsafipaaedtglivalsdwvleacctqlrawqqqgraaddltlsvn
    istrqfegehltravdralarsglrpdcleleitenvmlvmtdevrtcldalrargvrla
    lddfgtgysslsylsqlpfhglkidqsfvrkipahpsetqivttilalarglgmevvaeg
    ietaqqyaflrdrgcefgqgnlmstpqaadafaslldrqkasgqrpvhghetap
    

    Sequence, based on observed residues (ATOM records):
    >3n3tA (A:)
    erltldtrlrqalernelvlhyqpivelasgrivggealvrwedperglvmpsafipaae
    dtglivalsdwvleacctqlrawqqqgraaddltlsvnistrqfegehltravdralars
    glrpdcleleitenvmlvmtdevrtcldalrargvrlalddfgtgysslsylsqlpfhgl
    kidqsfvrkipahpsetqivttilalarglgmevvaegietaqqyaflrdrgcefgqgnl
    mstpqaadafaslldrqkas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n3tB (B:)
    mgsshhhhhhssgrenlyfqgherltldtrlrqalernelvlhyqpivelasgrivggea
    lvrwedperglvmpsafipaaedtglivalsdwvleacctqlrawqqqgraaddltlsvn
    istrqfegehltravdralarsglrpdcleleitenvmlvmtdevrtcldalrargvrla
    lddfgtgysslsylsqlpfhglkidqsfvrkipahpsetqivttilalarglgmevvaeg
    ietaqqyaflrdrgcefgqgnlmstpqaadafaslldrqkasgqrpvhghetap
    

    Sequence, based on observed residues (ATOM records):
    >3n3tB (B:)
    herltldtrlrqalernelvlhyqpivelasgrivggealvrwedperglvmpsafipaa
    edtglivalsdwvleacctqlrawqqqgraaddltlsvnistrqfegehltravdralar
    sglrpdcleleitenvmlvmtdevrtcldalrargvrlalddfgtgysslsylsqlpfhg
    lkidqsfvrkipahpsetqivttilalarglgmevvaegietaqqyaflrdrgcefgqgn
    lmstpqaadafaslldrqkas