PDB entry 3n3r

View 3n3r on RCSB PDB site
Description: Crystal structure of the E198A variant of catalase-peroxidase KatG of Burkholderia pseudomallei
Class: oxidoreductase
Keywords: Catalase-peroxidase, E198A variant, tuberclosis, Isonicotinic acid hydrazide binding, OXIDOREDUCTASE
Deposited on 2010-05-20, released 2010-06-16
Made obsolete by 5sxw on 2016-09-07

The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6TXM5 (Start-747)
      • engineered mutation (197)
    Domains in SCOPe 2.06: d3n3ra1, d3n3ra2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6TXM5 (Start-747)
      • engineered mutation (197)
    Domains in SCOPe 2.06: d3n3rb1, d3n3rb2
  • Heterogens: NA, HEM, CL, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n3rA (A:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepadvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaitsglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3rA (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepadvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n3rB (B:)
    mpgsdagprrrgvheqrrnrmsneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsd
    pmgkdfnyaqafekldlaavkrdlhalmttsqdwwpadfghygglfirmawhsagtyrta
    dgrggagegqqrfaplnswpdnanldkarrllwpikqkygraiswadlliltgnvalesm
    gfktfgfaggradtwepadvywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvn
    pegpdgnpdpvaaardirdtfarmamndeetvaliagghtfgkthgagpasnvgaepeaa
    gieaqglgwksayrtgkgadaitsglevtwtttptqwshnffenlfgyeweltkspagah
    qwvakgadavipdafdpskkhrptmlttdlslrfdpayekisrrfhenpeqfadafaraw
    fklthrdmgprarylgpevpaevllwqdpipavdhplidaadaaelkakvlasgltvsql
    vstawaaastfrgsdkrggangarirlapqkdweanqpeqlaavletleairtafngaqr
    ggkqvsladlivlagcagveqaaknaghavtvpfapgradasqeqtdvesmavlepvadg
    frnylkgkyrvpaevllvdkaqlltlsapemtvllgglrvlganvgqsrhgvftareqal
    tndffvnlldmgtewkptaadadvfegrdratgelkwtgtrvdlvfgshsqlralaevyg
    sadaqekfvrdfvavwnkvmnldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3rB (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepadvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla