PDB entry 3n3k

View 3n3k on RCSB PDB site
Description: The catalytic domain of USP8 in complex with a USP8 specific inhibitor
Class: hydrolase
Keywords: HYDROLASE, PROTEASE, THIOL PROTEASE, UBL CONJUGATION PATHWAY, DEUBIQUITINATING ENZYME, DUB, ZINC RIBBON, INHIBITOR, UBIQUITIN, Isopeptide bond, Nucleus, Phosphoprotein, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2010-05-20, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0055, UBPY, USP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n3ka_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: RPS27A, UBA52, UBA80, UBB, UBC, UBCEP1, UBCEP2, UBQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (3-End)
      • engineered mutant (4)
      • engineered mutant (6)
      • engineered mutant (11)
      • engineered mutant (13)
      • engineered mutant (16)
      • engineered mutant (64-66)
      • engineered mutant (68)
      • engineered mutant (70)
      • engineered mutant (72)
      • engineered mutant (74)
    Domains in SCOPe 2.07: d3n3kb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n3kA (A:)
    mgsshhhhhhssglvprgsptvtptvnrenkptcypkaeisrlsasqirnlnpvfggsgp
    altglrnlgntcymnsilqclcnaphladyfnrncyqddinrsnllghkgevaeefgiim
    kalwtgqyryispkdfkitigkindqfagysqqdsqelllflmdglhedlnkadnrkryk
    eenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvqcltchkksrtfeafmylsl
    plastskctlqdclrlfskeekltdnnrfycshcrarrdslkkieiwklppvllvhlkrf
    sydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfsvsnhyggldgghytayckn
    aarqrwfkfddhevsdisvssvkssaayilfytslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3kA (A:)
    rlsasqirnlnpvfggsgpaltglrnlgntcymnsilqclcnaphladyfnrncyqddin
    rsnllghkgevaeefgiimkalwtgqyryispkdfkitigkindqfagysqqdsqelllf
    lmdglhedlnkadnrkrykeenndhlddfkaaehawqkhkqlnesiivalfqgqfkstvq
    cltchkksrtfeafmylslplastskctlqdclrlfskeekltdnnrfycshcrarrdsl
    kkieiwklppvllvhlkrfsydgrwkqklqtsvdfplenldlsqyvigpknnlkkynlfs
    vsnhyggldgghytaycknaarqrwfkfddhevsdisvssvkssaayilfytslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n3kB (B:)
    gshmrivvktlmgrtiilevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dynihnhsalylllklrggggggsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3kB (B:)
    mrivvktlmgrtiilevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ihnhsalylllklr