PDB entry 3n3i

View 3n3i on RCSB PDB site
Description: Crystal Structure of G48V/C95F tethered HIV-1 Protease/Saquinavir complex
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, Saquinavir, Drug Resistance, tethered-dimer, fusion protein, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2010-05-20, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11706]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (104-202)
      • engineered mutation (47)
      • engineered mutation (94)
      • engineered mutation (151)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d3n3ia1, d3n3ia2
  • Heterogens: ROC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n3iA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigftlnfggssgpqvtlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigftlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3iA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmivgiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigftlnfpqvtlwqrplvtikiggqlke
    alldtgaddtvleemslpgrwkpkmivgiggfikvrqydqilieicghkaigtvlvgptp
    vniigrnlltqigftlnf