PDB entry 3n3e

View 3n3e on RCSB PDB site
Description: zebrafish alphaa crystallin
Deposited on 2010-05-19, released 2010-08-11
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha A crystallin
    Species: Danio rerio [TaxId:7955]
    Gene: cryaa
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Alpha A crystallin
    Species: Danio rerio [TaxId:7955]
    Gene: cryaa
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n3eA (A:)
    gvsevrsdrekftvyldvkhfspdelsvkvtddyveiqgkhgerqddhgyisrefhrryr
    lpsnvdqsaitctlsadglltlcgpktsgidagrgdrtipvtredk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n3eB (B:)
    gvsevrsdrekftvyldvkhfspdelsvkvtddyveiqgkhgerqddhgyisrefhrryr
    lpsnvdqsaitctlsadglltlcgpktsgidagrgdrtipvtredk
    

    Sequence, based on observed residues (ATOM records):
    >3n3eB (B:)
    vsevrsdrekftvyldvkhfspdelsvkvtddyveiqgkhgerqddhgyisrefhrryrl
    psnvdqsaitctlsadglltlcgpktsgidagrgdrtipvtred