PDB entry 3n3d

View 3n3d on RCSB PDB site
Description: crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367
Deposited on 2010-05-19, released 2010-06-02
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: LVIS_1638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03Q08
      • conflict (65)
      • conflict (129)
      • conflict (145)
      • conflict (200)
      • conflict (203)
      • conflict (227)
      • conflict (292)
      • conflict (307)
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: LVIS_1638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03Q08
      • expression tag (2)
      • conflict (65)
      • conflict (129)
      • conflict (145)
      • conflict (200)
      • conflict (203)
      • conflict (227)
      • conflict (292)
      • conflict (307)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n3dA (A:)
    msldrqlwrqfpqvepqltalqdyllrtvqldnqpihhkilallksggkllrpgyfylfs
    tfgnaatpaqlqagaaaieilhvgtlihddviddsptrrgvrtiqmtygqrnaiyagdfm
    ftvyfdqvlksttdrsliqnhidamhrilqgelhqmdlnyreditldaylneiagktael
    falscyqgaqlagapqsvidrtrdigiaigcayqmlddildyagdpkrtqkpvledlrsg
    vyslplllslshaprdfhkllkkkqamtledikhvqalvaqydgvgaakqlaqdytdral
    tliqqlpvgsaqqsleqltrlllrrdheghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n3dA (A:)
    drqlwrqfpqvepqltalqdyllrtvqldnqpihhkilallksggkllrpgyfylfstfg
    naatpaqlqagaaaieilhvgtlihddviddsptrrgvrtiqmtygqrnaiyagdfmftv
    yfdqvlksttdrsliqnhidamhrilqgelhqmdlnyreditldaylneiagktaelfal
    scyqgaqlagapqsvidrtrdigiaigcayqmlddildyagdpkrtqkpvledlrsgvys
    lplllslshaprdfhkllkkkqamtledikhvqalvaqydgvgaakqlaqdytdraltli
    qqlpvgsaqqsleqltrlllrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n3dB (B:)
    msldrqlwrqfpqvepqltalqdyllrtvqldnqpihhkilallksggkllrpgyfylfs
    tfgnaatpaqlqagaaaieilhvgtlihddviddsptrrgvrtiqmtygqrnaiyagdfm
    ftvyfdqvlksttdrsliqnhidamhrilqgelhqmdlnyreditldaylneiagktael
    falscyqgaqlagapqsvidrtrdigiaigcayqmlddildyagdpkrtqkpvledlrsg
    vyslplllslshaprdfhkllkkkqamtledikhvqalvaqydgvgaakqlaqdytdral
    tliqqlpvgsaqqsleqltrlllrrdheghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n3dB (B:)
    ldrqlwrqfpqvepqltalqdyllrtvqldnqpihhkilallksggkllrpgyfylfstf
    gnaatpaqlqagaaaieilhvgtlihddviddqmtygqrnaiyagdfmftvyfdqvlkst
    tdrsliqnhidamhrilqgelhqmdlnyreditldaylneiagktaelfalscyqgaqla
    gapqsvidrtrdigiaigcayqmlddildyagdpkrtqkpvledlrsgvyslplllslsh
    aprdfhkllkkkqamtledikhvqalvaqydgvgaakqlaqdytdraltliqqlpvgsaq
    qsleqltrlllrr