PDB entry 3n3c

View 3n3c on RCSB PDB site
Description: crystal structure of native bovine pdp1c
Deposited on 2010-05-19, released 2011-06-01
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase phosphatase 1
    Species: Bos taurus [TaxId:9913]
    Gene: PDP, PDP1, PPM2C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n3cA (A:)
    astpqkfyltppqvnsilkaneysfkvpefdgknvssvlgfdsnqlpanapiedrrsaat
    clqtrgmllgvfdghagcacsqavserlfyyiavsllphetlleienavesgrallpilq
    whkhpndyfskeasklyfnslrtywqelidlntgestdidvkealinafkrldndislea
    qvgdpnsflnylvlrvafsgatacvahvdgvdlhvantgdsramlgvqeedgswsavtls
    ndhnaqnereverlklehpkneaksvvkqdrllgllmpfrafgdvkfkwsidlqkrvies
    gpdqlndneytkfippnyytppyltaepevtyhrlrpqdkflvlatdglwetmhrqdvvr
    ivgeyltgmhhqqpiavggykvtlgqmhgllterrakmssvfedqnaathlirhavgnne
    fgavdherlskmlslpeelarmyrdditiivvqfnshvvgayqnqeq
    

    Sequence, based on observed residues (ATOM records):
    >3n3cA (A:)
    ppqvnsilkaneysfkvpefdgknvssvlgfdsnqlpanapiedrrsaatclqtrgmllg
    vfdghagcacsqavserlfyyiavsllphetlleienallpilqwhkhpndyfskeaskl
    yfnslrtywqelididvkealinafkrldndisleaqvgdpnsflnylvlrvafsgatac
    vahvdgvdlhvantgdsramlgvqeedgswsavtlsndhnaqnereverlklehpkneak
    svvkqdrllgllmpfrafgdvkfkwsidlqkrviekfippnyytppyltaepevtyhrlr
    pqdkflvlatdglwetmhrqdvvrivgeyltgmqnaathlirhavkmlslpeelarmyrd
    ditiivvqfnshvvgayq