PDB entry 3n3b

View 3n3b on RCSB PDB site
Description: Ribonucleotide Reductase Dimanganese(II)-NrdF from Escherichia coli in Complex with Reduced NrdI with a Trapped Peroxide
Class: oxidoreductase
Keywords: ribonucleotide reductase, four-helix bundle, dimanganese cluster, flavoprotein, peroxide, OXIDOREDUCTASE
Deposited on 2010-05-19, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.236
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleoside-diphosphate reductase 2 subunit beta
    Species: Escherichia coli [TaxId:83333]
    Gene: b2676, JW2651, nrdF, ygaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n3ba_
  • Chain 'B':
    Compound: Ribonucleoside-diphosphate reductase 2 subunit beta
    Species: Escherichia coli [TaxId:83333]
    Gene: b2676, JW2651, nrdF, ygaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n3bb_
  • Chain 'C':
    Compound: Protein nrdI
    Species: Escherichia coli [TaxId:83333]
    Gene: nrdI, ygaO, b2674, JW2649
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein nrdI
    Species: Escherichia coli [TaxId:83333]
    Gene: nrdI, ygaO, b2674, JW2649
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, PEO, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n3bA (A:)
    mklsrisainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvf
    tgltlldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvda
    ayawseenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdel
    yaetpwaddvkaflcynankalmnlgyeplfpaemaevnpailaalspnadenhdffsgs
    gssyvmgkavetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3bA (A:)
    risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt
    lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw
    seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl
    irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet
    pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n3bB (B:)
    mklsrisainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvf
    tgltlldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvda
    ayawseenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltn
    tadlirliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdel
    yaetpwaddvkaflcynankalmnlgyeplfpaemaevnpailaalspnadenhdffsgs
    gssyvmgkavetededwnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n3bB (B:)
    risainwnkisddkdlevwnrltsnfwlpekvplsndipawqtltvveqqltmrvftglt
    lldtlqnvigapslmpdaltpheeavlsnisfmeavharsyssifstlcqtkdvdaayaw
    seenaplqrkaqiiqqhyrgddplkkkiasvflesflfysgfwlpmyfssrgkltntadl
    irliirdeavhgyyigykyqknmekislgqreelksfafdlllelydnelqytdelyaet
    pwaddvkaflcynankalmnlgyeplfpaemaevnpailaalsp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.