PDB entry 3n36

View 3n36 on RCSB PDB site
Description: Erythrina corallodendron lectin mutant (Y106G) in complex with Galactose
Class: Sugar Binding Protein
Keywords: LEGUME LECTIN, GLYCOSYLATION, ERYTHRINA LECTIN, SUGAR, RECOMBINANT LECTIN, Sugar Binding Protein
Deposited on 2010-05-19, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Erythrina corallodendron [TaxId:3843]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-241)
      • conflict (23)
      • engineered mutation (105)
      • see remark 999 (133)
    Domains in SCOPe 2.07: d3n36a_
  • Heterogens: MN, CA, GLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n36A (A:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgggylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpet
    nd