PDB entry 3n34

View 3n34 on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP, produced from 5-fluoro-6-azido-UMP
Class: lyase
Keywords: P. falciparum, orotidine 5'-monophosphate decarboxylase, 5-fluoro-6-amino-UMP, 5-fluoro-6-azido-UMP, LYASE
Deposited on 2010-05-19, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.157
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJH3 (19-End)
      • expression tag (12-18)
    Domains in SCOPe 2.07: d3n34a1, d3n34a2
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: gi|9310996, PF10_0225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJH3 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d3n34b1, d3n34b2
  • Heterogens: FNU, PGE, PO4, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n34A (A:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n34A (A:)
    glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
    nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
    vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
    kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
    nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
    raitknpypqkaaqmyydqinailkqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n34B (B:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n34B (B:)
    smgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsik
    kdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvl
    knvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyd
    eeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigf
    vvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitkn
    pypqkaaqmyydqinailkqnm