PDB entry 3n2z

View 3n2z on RCSB PDB site
Description: the structure of human prolylcarboxypeptidase at 2.80 angstroms resolution
Deposited on 2010-05-19, released 2010-07-07
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Lysosomal Pro-X carboxypeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRCP, PCP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n2zB (B:)
    knysvlyfqqkvdhfgfntvktfnqrylvadkywkknggsilfytgnegdiiwfcnntgf
    mwdvaeelkamlvfaehryygeslpfgdnsfkdsrhlnfltseqaladfaelikhlkrti
    pgaenqpviaiggsyggmlaawfrmkyphmvvgalaasapiwqfedlvpcgvfmkivttd
    frksgphcsesihrswdainrlsntgsglqwltgalhlcspltsqdiqhlkdwisetwvn
    lamvdypyasnflqplpawpikvvcqylknpnvsdslllqnifqalnvyynysgqvkcln
    isetatsslgtlgwsyqactevvmpfctngvddmfephswnlkelsddcfqqwgvrprps
    wittmyggknisshtnivfsngeldpwsgggvtkditdtlvavtisegahhldlrtknal
    dpmsvllarslevrhmknwirdfyds
    

    Sequence, based on observed residues (ATOM records):
    >3n2zB (B:)
    knysvlyfqqkvdhfgfntvktfnqrylvadkywkknggsilfytgnegdiiwfcnntgf
    mwdvaeelkamlvfaehryygeslpfgdnsfkdsrhlnfltseqaladfaelikhlkrti
    pgaenqpviaiggsyggmlaawfrmkyphmvvgalaasapiwqfedlvpcgvfmkivttd
    frksgphcsesihrswdainrlsntgsglqwltgalhlcspltsqdiqhlkdwisetwvn
    lamvdypyasnflqplpawpikvvcqylknpnvsdslllqnifqalnvyynysgqvkcln
    iseslgtlgwsyqactevvmpfctngvddmfephswnlkelsddcfqqwgvrprpswitt
    myggknisshtnivfsngeldpwsgggvtkditdtlvavtisegahhldlrtknaldpms
    vllarslevrhmknwirdfyds