PDB entry 3n2y

View 3n2y on RCSB PDB site
Description: Crystal structure of tyrosyl-tRNA synthetase complexed with p-(2-tetrazolyl)-phenylalanine
Class: ligase
Keywords: AMINOACYL-TRNA SYNTHETASE, Photoclick Chemistry, p-(2-tetrazolyl)-phenylalanine, LIGASE
Deposited on 2010-05-19, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (108)
      • engineered mutation (157)
      • engineered mutation (161)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d3n2ya_
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (108)
      • engineered mutation (157)
      • engineered mutation (161)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d3n2yb_
  • Heterogens: TEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n2yA (A:)
    mdefemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagf
    diiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2yA (A:)
    defemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagfd
    iiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyrl
    alkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmlar
    ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
    meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
    irkrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n2yB (B:)
    mdefemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagf
    diiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2yB (B:)
    defemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagfd
    iiiiladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsefmldkdytlnvyrl
    alkttlkrarrsmeliaredenpkvaeviypimqvngihyvggdvavggmeqrkihmlar
    ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
    meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
    irkrl