PDB entry 3n2t

View 3n2t on RCSB PDB site
Description: Structure of the glycerol dehydrogenase AKR11B4 from Gluconobacter oxydans
Class: oxidoreductase
Keywords: ALDO/KETO Reductase superfamily, AKR, AKR11B4, TIM BARREL, OXIDOREDUCTASE
Deposited on 2010-05-19, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: GOX1615
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n2tA (A:)
    hhhhhhssglvprgshmasdtiripgidtplsrvalgtwaiggwmwggpdddngvrtiha
    aldeginlidtapvygfghseeivgralaekpnkahvatklglhwvgedeknmkvfrdsr
    parirkevedslrrlrvetidleqihwpddktpidesarelqklhqdgkiralgvsnfsp
    eqmdifrevaplatiqpplnlfertiekdilpyaekhnavvlaygalcrglltgkmnrdt
    tfpkddlrsndpkfqkpnfekylaamdefeklaekrgksvmafavrwvldqgpvialwga
    rkpgqvsgvkdvfgwsltdeekkavddilarhvpnpidptfmappard
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2tA (A:)
    masdtiripgidtplsrvalgtwaiggwmwggpdddngvrtihaaldeginlidtapvyg
    fghseeivgralaekpnkahvatklglhwvgedeknmkvfrdsrparirkevedslrrlr
    vetidleqihwpddktpidesarelqklhqdgkiralgvsnfspeqmdifrevaplatiq
    pplnlfertiekdilpyaekhnavvlaygalcrglltgkmnrdttfpkddlrsndpkfqk
    pnfekylaamdefeklaekrgksvmafavrwvldqgpvialwgarkpgqvsgvkdvfgws
    ltdeekkavddilarhvpnpidptfma