PDB entry 3n2s

View 3n2s on RCSB PDB site
Description: Structure of NfrA1 nitroreductase from B. subtilis
Class: oxidoreductase
Keywords: alpga-beta-alpha sandwich, OXIDOREDUCTASE
Deposited on 2010-05-19, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH-dependent nitro/flavin reductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nfrA1, nfrA, ywcG, BSU38110, ipa-43d
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2sa_
  • Chain 'B':
    Compound: NADPH-dependent nitro/flavin reductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nfrA1, nfrA, ywcG, BSU38110, ipa-43d
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2sb_
  • Chain 'C':
    Compound: NADPH-dependent nitro/flavin reductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nfrA1, nfrA, ywcG, BSU38110, ipa-43d
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2sc_
  • Chain 'D':
    Compound: NADPH-dependent nitro/flavin reductase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nfrA1, nfrA, ywcG, BSU38110, ipa-43d
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2sd_
  • Heterogens: FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n2sA (A:)
    mnntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrel
    svlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqn
    msiaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqa
    vyhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndy
    vkekgfnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2sA (A:)
    nntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrels
    vlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnm
    siaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqav
    yhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyv
    kekgfnkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n2sB (B:)
    mnntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrel
    svlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqn
    msiaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqa
    vyhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndy
    vkekgfnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2sB (B:)
    nntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrels
    vlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnm
    siaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqav
    yhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyv
    kekgfnkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n2sC (C:)
    mnntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrel
    svlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqn
    msiaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqa
    vyhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndy
    vkekgfnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2sC (C:)
    nntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrels
    vlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnm
    siaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqav
    yhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyv
    kekgfnkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n2sD (D:)
    mnntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrel
    svlagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqn
    msiaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqa
    vyhentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndy
    vkekgfnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2sD (D:)
    ntietilnhrsirsftdqlltaeeidtlvksaqaastssyvqaysiigvsdpekkrelsv
    lagnqpyveknghffvfcadlyrhqqlaeekgehisellentemfmvslidaalaaqnms
    iaaesmglgicyiggirneldkvtevlqtpdhvlplfglavghpanlsgkkprlpkqavy
    hentynvntddfrhtmntydktisdyyrertngkreetwsdqilnfmkqkprtylndyvk
    ekgfnkn