PDB entry 3n2q

View 3n2q on RCSB PDB site
Description: crystal structure of sex pheromone staph-cam373 precursor
Deposited on 2010-05-18, released 2010-06-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sex pheromone staph-cAM373
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_4675
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816Y4 (3-286)
      • expression tag (1-2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n2qA (A:)
    snaplkeqkvintaniktnskldlaeyengliniatqqfdteshvlqlnqyipeklidel
    vakveapvltniieqdyfgkqnsnelslsgvmiglamsssvsneeamskgtevakqliea
    inkndkynkspitfaifkqestsslkngtyiasatvqkndtnlgnwstideksysypsde
    ftqahgedntkinnfakeikgfsngdfipvnakvsykkdqmdtlnmnivikyngktelma
    ltqlaaqgmldklpkdakvqlqikseskieaviikeknsdkpfvsfl
    

    Sequence, based on observed residues (ATOM records):
    >3n2qA (A:)
    naplkeqkvintaniktnskldlaeyengliniatqqfdteshvlqlnqyipeklidelv
    akveapvltniieqdyfgknelslsgvmiglamsssvsneeamskgtevakqlieainkn
    dkynkspitfaifkqestsslkngtyiasatvqkndtnlgnwstideksysypsdeftqa
    hgedntkinnfakeikgfngdfipvnakvsykkdqmdtlnmnivikyngktelmaltqla
    aqgmldklpkdakvqlqikseskieaviikeknsdkpfvsfl