PDB entry 3n2o

View 3n2o on RCSB PDB site
Description: X-ray crystal structure of arginine decarboxylase complexed with Arginine from Vibrio vulnificus
Deposited on 2010-05-18, released 2010-06-09
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biosynthetic arginine decarboxylase
    Species: Vibrio vulnificus [TaxId:196600]
    Gene: ADC, speA, VV1986
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Biosynthetic arginine decarboxylase
    Species: Vibrio vulnificus [TaxId:196600]
    Gene: ADC, speA, VV1986
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Biosynthetic arginine decarboxylase
    Species: Vibrio vulnificus [TaxId:196600]
    Gene: ADC, speA, VV1986
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Biosynthetic arginine decarboxylase
    Species: Vibrio vulnificus [TaxId:196600]
    Gene: ADC, speA, VV1986
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, AG2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n2oA (A:)
    mrldveqtskldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleer
    qlnvpvlvrfpqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasq
    aqletkqlgleagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivl
    ekmseldlvlreakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrl
    kkenqldtlqlvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidy
    dgtrsqssnsmnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvi
    gtetykpetvtepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfat
    gvltlehrawaeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpd
    swgidqvfpvlplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedep
    ylmgfflvgayqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidv
    dqirknyhslvsqrvdqeeqqqilaeleqglsgytyledflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2oA (A:)
    kldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleerqlnvpvlvr
    fpqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasqaqletkqlg
    leagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivlekmseldlv
    lreakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrlkkenqldtl
    qlvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidydgtrsqssn
    smnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvigtetykpet
    vtepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfatgvltlehra
    waeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpdswgidqvfp
    vlplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedepylmgfflvg
    ayqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidvdqirknyhs
    lvsqrvdqeeqqqilaeleqglsgytyled
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n2oB (B:)
    mrldveqtskldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleer
    qlnvpvlvrfpqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasq
    aqletkqlgleagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivl
    ekmseldlvlreakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrl
    kkenqldtlqlvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidy
    dgtrsqssnsmnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvi
    gtetykpetvtepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfat
    gvltlehrawaeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpd
    swgidqvfpvlplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedep
    ylmgfflvgayqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidv
    dqirknyhslvsqrvdqeeqqqilaeleqglsgytyledflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2oB (B:)
    ldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleerqlnvpvlvrf
    pqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasqaqletkqlgl
    eagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivlekmseldlvl
    reakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrlkkenqldtlq
    lvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidydgtrsqssns
    mnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvigtetykpetv
    tepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfatgvltlehraw
    aeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpdswgidqvfpv
    lplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedepylmgfflvga
    yqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidvdqirknyhsl
    vsqrvdqeeqqqilaeleqglsgytyled
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n2oC (C:)
    mrldveqtskldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleer
    qlnvpvlvrfpqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasq
    aqletkqlgleagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivl
    ekmseldlvlreakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrl
    kkenqldtlqlvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidy
    dgtrsqssnsmnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvi
    gtetykpetvtepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfat
    gvltlehrawaeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpd
    swgidqvfpvlplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedep
    ylmgfflvgayqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidv
    dqirknyhslvsqrvdqeeqqqilaeleqglsgytyledflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2oC (C:)
    drvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleerqlnvpvlvrfp
    qilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasqaqletkqlgle
    agskpellavlamaqhassvivcngykdreyirlaligeklghkvfivlekmseldlvlr
    eakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrlkkenqldtlql
    vhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidydgtrsqssnsm
    nyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvigtetykpetvt
    epeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfatgvltlehrawa
    eqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpdswgidqvfpvl
    plsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedepylmgfflvgay
    qeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidvdqirknyhslv
    sqrvdqeeqqqilaeleqglsgytyled
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n2oD (D:)
    mrldveqtskldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleer
    qlnvpvlvrfpqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasq
    aqletkqlgleagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivl
    ekmseldlvlreakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrl
    kkenqldtlqlvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidy
    dgtrsqssnsmnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvi
    gtetykpetvtepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfat
    gvltlehrawaeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpd
    swgidqvfpvlplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedep
    ylmgfflvgayqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidv
    dqirknyhslvsqrvdqeeqqqilaeleqglsgytyledflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2oD (D:)
    ldrvradynvhywsqgfygiddqgemyvsprsdnahqiqlskivkqleerqlnvpvlvrf
    pqilhqrvhsicdafnqaieeyqypnkyllvypikvnqqrevvdeilasqaqletkqlgl
    eagskpellavlamaqhassvivcngykdreyirlaligeklghkvfivlekmseldlvl
    reakslgvtprlgirirlasqgagkwqasggekskfglsasqvlnvisrlkkenqldtlq
    lvhfhlgsqmanirdvrngvnesarfycelrtlganityfdvggglaidydgtrsqssns
    mnyglveyarnivntvgdvckdykqpmpviisesgrsltahhavlisnvigtetykpetv
    tepeedfplllnnmwrswlnlhngtdaralieiyndtqsdlaevhsqfatgvltlehraw
    aeqtslriyyelnrlmstknrfhrpildelserladkffvnfslfqslpdswgidqvfpv
    lplsglqnaadrravmlditcdsdgaidayvdgqgiestlpvpawnedepylmgfflvga
    yqeilgdmhnlfgdthsvvvnvgdqgeinidfinegdtvedmmryvhidvdqirknyhsl
    vsqrvdqeeqqqilaeleqglsgytyled