PDB entry 3n2n

View 3n2n on RCSB PDB site
Description: The Crystal Structure of Tumor Endothelial Marker 8 (TEM8) extracellular domain
Class: toxin receptor
Keywords: Rossmann fold, TOXIN RECEPTOR, Anthrax
Deposited on 2010-05-18, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2na1, d3n2na2
  • Chain 'B':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2nb1, d3n2nb2
  • Chain 'C':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2nc1, d3n2nc2
  • Chain 'D':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2nd1, d3n2nd2
  • Chain 'E':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2ne1, d3n2ne2
  • Chain 'F':
    Compound: Anthrax toxin receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR1, ATR, TEM8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6X2 (2-184)
      • expression tag (0-1)
      • engineered mutation (141)
    Domains in SCOPe 2.07: d3n2nf1, d3n2nf2
  • Heterogens: ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nA (A:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nB (B:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nC (C:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nD (D:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nE (E:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2nF (F:)
    smacyggfdlyfildksgsvlhhwneiyyfveqlahkfispqlrmsfivfstrgttlmkl
    tedreqirqgleelqkvlpggdtymhegferaseqiyyenrqgyrtasviialtdgelhe
    dlffysereanrsrdlgaivyavgvkdfnetqlariadskdhvfpvndgfqalqgiihsi
    lkksc