PDB entry 3n2l

View 3n2l on RCSB PDB site
Description: 2.1 Angstrom resolution crystal structure of an Orotate Phosphoribosyltransferase (pyrE) from Vibrio cholerae O1 biovar eltor str. N16961
Class: transferase
Keywords: Orotate Phosphoribosyltransferase, Pyrimidine Ribonucleotide Biosynthesis, Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, Glycosyltransferase, Magnesium, Pyrimidine biosynthesis, Transferase
Deposited on 2010-05-18, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2la_
  • Chain 'B':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVD5 (25-End)
      • expression tag (24)
    Domains in SCOPe 2.07: d3n2lb1, d3n2lb2
  • Chain 'C':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2lc_
  • Chain 'D':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2ld_
  • Chain 'E':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2le_
  • Chain 'F':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2lf_
  • Chain 'G':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2lg_
  • Chain 'H':
    Compound: orotate phosphoribosyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrE, VC_0211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n2lh_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n2lA (A:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lA (A:)
    mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds
    giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvit
    agtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavisivsltdli
    tyleqqgnntehleavkayraqygi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n2lB (B:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lB (B:)
    mmkayqrefiefalekqvlkfgeftlkrkspyffnaglfntgrdlarlgrfyaaalvdsg
    iefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvita
    gtairesmeliqankadlagvlvaidraiqeverdfgcavisivsltdlityleq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n2lC (C:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lC (C:)
    mkayqrefiefalekqvlkfgeftlrkspyffnaglfntgrdlarlgrfyaaalvdsgie
    fdvlfgpaykgipiatttavaladhhdvdtpycfnrknlvgsklegrvmlvddvitires
    meliqankadlagvlvaidrqeklsaiqeverdfgcavisivsltdlityleqqgnnteh
    leavkayraqygi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n2lD (D:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lD (D:)
    mkayqrefiefalekqvlkfgeftgrkspyffnaglfntgrdlarlgrfyaaalvdsgie
    fdvlfgpaykgipiatttavaladhhdvdtpycfnrklvgsklegrvmlvddvittaire
    smeliqankadlagvlvaidrqaiqeverdfgcavisivsltdlityleq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n2lE (E:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lE (E:)
    mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds
    giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvit
    agtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavisivsltdli
    tyleqqgnntehleavkayraqygi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n2lF (F:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lF (F:)
    mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds
    giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvit
    agtairesmeliqankadlagvlvaidrqaiqeverdfgcavisivsltdlityleq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3n2lG (G:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lG (G:)
    mkayqrefiefalekqvlkfgeftlrkspyffnaglfntgrdlarlgrfyaaalvdsgie
    fdvlfgpaykgipiatttavaladhhdvdtpycfnrknlvgsklegrvmlvddvitaire
    smeliqankadlagvlvaidrqekgsaiqeverdfgcavisivsltdlityleqqgnnte
    hleavkayraqygi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3n2lH (H:)
    mhhhhhhssgvdlgtenlyfqsnammkayqrefiefalekqvlkfgeftlksgrkspyff
    naglfntgrdlarlgrfyaaalvdsgiefdvlfgpaykgipiatttavaladhhdvdtpy
    cfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesmeliqankadlagvlvaid
    rqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavkayraqygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2lH (H:)
    mkayqrefiefalekqvlkfgeftkspyffnaglfntgrdlarlgrfyaaalvdsgiefd
    vlfgpaykgipiatttavaladhhdvdtpycfnrknlvgsklegrvmlvddvittaires
    meliqankadlagvlvaidrqaiqeverdfgcavisivsltdlityleq