PDB entry 3n2g

View 3n2g on RCSB PDB site
Description: tubulin-nsc 613863: rb3 stathmin-like domain complex
Deposited on 2010-05-18, released 2010-07-28
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.211
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043 (1-End)
      • expression tag (0)
  • Heterogens: GTP, MG, GDP, G2N

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n2gA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records):
    >3n2gA (A:)
    recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
    eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
    glqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
    thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfdgalnv
    dltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkcdprhg
    kymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdlak
    vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
    dyeevgvd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n2gB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records):
    >3n2gB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdsknmmaacdprhgr
    yltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
    nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n2gC (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records):
    >3n2gC (C:)
    recisihvgqagvqignacwelyclehgiqpdgqmpsdktigdsfntffsetgagkhvpr
    avfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirk
    ladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvep
    ynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrf
    dgalnvdltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprh
    gkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpggdla
    kvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaale
    kdyeevgvd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n2gD (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records):
    >3n2gD (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqda
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n2gE (E:)
    admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
    qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
    qekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records):
    >3n2gE (E:)
    admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
    hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
    elk