PDB entry 3n2c

View 3n2c on RCSB PDB site
Description: Crystal structure of prolidase eah89906 complexed with n-methylphosphonate-l-proline
Deposited on 2010-05-17, released 2010-06-02
The last revision was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'B':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'C':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'D':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'E':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'F':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'G':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'H':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'I':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'J':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'K':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'L':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'M':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'N':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'O':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Chain 'P':
    Compound: prolidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N2C
  • Heterogens: ZN, LWY

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n2cA (A:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cA (A:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n2cB (B:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cB (B:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n2cC (C:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cC (C:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n2cD (D:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cD (D:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n2cE (E:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cE (E:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n2cF (F:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cF (F:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n2cG (G:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cG (G:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n2cH (H:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cH (H:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3n2cI (I:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cI (I:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3n2cJ (J:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cJ (J:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3n2cK (K:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cK (K:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3n2cL (L:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cL (L:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3n2cM (M:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cM (M:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3n2cN (N:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cN (N:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3n2cO (O:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cO (O:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3n2cP (P:)
    msltitvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpg
    fidchvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqave
    tglvsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavre
    eiqkgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiar
    avrcgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasv
    qqkgresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeiv
    nmqgqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrqaagreghhh
    hhh
    

    Sequence, based on observed residues (ATOM records):
    >3n2cP (P:)
    titvlqggnvldlergvllehhhvvidgerivevtdrpvdlpnaqaidvrgktvmpgfid
    chvhvlasnanlgvnatqpnilaairslpildamlsrgftsvrdaggadwslmqavetgl
    vsgprifpsgkalsqtgghgdfrprgdllepcsccfrtgaiarvvdgvegvrlavreeiq
    kgatqikimasggvasptdpiantqysedeiraivdeaeaantyvmahaytgraiaravr
    cgvrtiehgnlvdeaaaklmhehgafvvptlvtydalakhgaefgmppesvakvasvqqk
    gresleiyanagvkmgfgsdllgemhafqsgefriraevlgnlealrsattvaaeivnmq
    gqlgviavgaiadlvvldgnpledigvvadegarveyvlqrgtlvkrq