PDB entry 3n2b

View 3n2b on RCSB PDB site
Description: 1.8 angstrom resolution crystal structure of diaminopimelate decarboxylase (lysa) from vibrio cholerae.
Deposited on 2010-05-17, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelate decarboxylase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: lysA, VC_0125
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVL7 (24-440)
      • expression tag (16-23)
  • Chain 'B':
    Compound: diaminopimelate decarboxylase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: lysA, VC_0125
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: diaminopimelate decarboxylase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: lysA, VC_0125
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KVL7 (24-440)
      • expression tag (17-23)
  • Chain 'D':
    Compound: diaminopimelate decarboxylase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: lysA, VC_0125
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n2bA (A:)
    mhhhhhhssgvdlgtenlyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysra
    tlerhwhafdksvgdyphlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggd
    pskvvfsgvgkteaemkralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvd
    akthpyistglrdnkfgitfdraaqvyrlahslpnldvhgidchigsqltalapfidatd
    rllalidslkaegihirhldvggglgvvyrdelppqpseyakalldrlerhrdlelifep
    graiaanagvlvtkveflkhtehknfaiidaamndlirpalyqawqdiiplrprqgeaqt
    ydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssnyntrprvaevmvdgnkt
    ylvrqreelsslwalesvlpe
    

    Sequence, based on observed residues (ATOM records):
    >3n2bA (A:)
    nlyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysratlerhwhafdksvgdy
    phlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggdpskvvfsgvgkteaem
    kralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvdakthpyistglrdnkf
    gitfdraaqvyrlahslpnldvhgidchigsqltalapfidatdrllalidslkaegihi
    rhldvggglgvvypqpseyakalldrlerhrdlelifepgraiaanagvlvtkveflkht
    knfaiidaamndlirqdiiplrprqgeaqtydlvgpvcetsdflgkdrdlvlqegdllav
    rssgaygftmssnyntrprvaevmvdgnktylvrqreelsslwalesvlpe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n2bB (B:)
    mhhhhhhssgvdlgtenlyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysra
    tlerhwhafdksvgdyphlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggd
    pskvvfsgvgkteaemkralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvd
    akthpyistglrdnkfgitfdraaqvyrlahslpnldvhgidchigsqltalapfidatd
    rllalidslkaegihirhldvggglgvvyrdelppqpseyakalldrlerhrdlelifep
    graiaanagvlvtkveflkhtehknfaiidaamndlirpalyqawqdiiplrprqgeaqt
    ydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssnyntrprvaevmvdgnkt
    ylvrqreelsslwalesvlpe
    

    Sequence, based on observed residues (ATOM records):
    >3n2bB (B:)
    mdyfnyqedgqlwaeqvpladlanqygtplyvysratlerhwhafdksvgdyphlicyav
    kansnlgvlntlarlgsgfdivsvgelervlaaggdpskvvfsgvgkteaemkralqlki
    kcfnvesepelqrlnkvagelgvkapislrinpdvfgitfdraaqvyrlahslpnldvhg
    idchiglapfidatdrllalidslkaegihirhldvggglgvvyppqpseyakalldrle
    rhrdlelifepgraiaanagvlvtkveflkhtehknfaiidaamndlirpalyqawqdii
    plrprqgeaqtydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssnyntrpr
    vaevmvdgnktylvrqreelsslwalesvlpe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n2bC (C:)
    mhhhhhhssgvdlgtenlyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysra
    tlerhwhafdksvgdyphlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggd
    pskvvfsgvgkteaemkralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvd
    akthpyistglrdnkfgitfdraaqvyrlahslpnldvhgidchigsqltalapfidatd
    rllalidslkaegihirhldvggglgvvyrdelppqpseyakalldrlerhrdlelifep
    graiaanagvlvtkveflkhtehknfaiidaamndlirpalyqawqdiiplrprqgeaqt
    ydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssnyntrprvaevmvdgnkt
    ylvrqreelsslwalesvlpe
    

    Sequence, based on observed residues (ATOM records):
    >3n2bC (C:)
    lyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysratlerhwhafdksvgdyp
    hlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggdpskvvfsgvgkteaemk
    ralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvdakthpyistglrdnkfg
    itfdraaqvyrlahslpnldvhgidchigsqltalapfidatdrllalidslkaegihir
    hldvggglgvvqpseyakalldrlerhrdlelifepgraiaanagvlvtkveflkhtehk
    nfaiidaamndlirwqdiiplrprqgeaqtydlvgpvcetsdflgkdrdlvlqegdllav
    rssgaygftmssnyntrprvaevmvdgnktylvrqreelsslwalesvlpe
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n2bD (D:)
    mhhhhhhssgvdlgtenlyfqsnamdyfnyqedgqlwaeqvpladlanqygtplyvysra
    tlerhwhafdksvgdyphlicyavkansnlgvlntlarlgsgfdivsvgelervlaaggd
    pskvvfsgvgkteaemkralqlkikcfnvesepelqrlnkvagelgvkapislrinpdvd
    akthpyistglrdnkfgitfdraaqvyrlahslpnldvhgidchigsqltalapfidatd
    rllalidslkaegihirhldvggglgvvyrdelppqpseyakalldrlerhrdlelifep
    graiaanagvlvtkveflkhtehknfaiidaamndlirpalyqawqdiiplrprqgeaqt
    ydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssnyntrprvaevmvdgnkt
    ylvrqreelsslwalesvlpe
    

    Sequence, based on observed residues (ATOM records):
    >3n2bD (D:)
    mdyfnyqedgqlwaeqvpladlanqygtplyvysratlerhwhafdksvgdyphlicyav
    kansnlgvlntlarlgsgfdivsvgelervlaaggdpskvvfsgvgkteaemkralqlki
    kcfnvesepelqrlnkvagelgvkapislrinpdvdakthpyistglrdnkfgitfdraa
    qvyrlahslpnldvhgidchigsqltalapfidatdrllalidslkaegihirhldvggg
    lseyakalldrlerhrdlelifepgraiaanagvlvtkveflkhtehknfaiidaamndl
    iwqdiiplrprqgeaqtydlvgpvcetsdflgkdrdlvlqegdllavrssgaygftmssn
    yntrprvaevmvdgnktylvrqreelsslwalesvlpe