PDB entry 3n29

View 3n29 on RCSB PDB site
Description: Crystal structure of carboxynorspermidine decarboxylase complexed with Norspermidine from Campylobacter jejuni
Deposited on 2010-05-17, released 2010-06-09
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxynorspermidine decarboxylase
    Species: Campylobacter jejuni subsp. jejuni 81116 [TaxId:407148]
    Gene: carboxynorspermidine decarboxylase, CJJHB9313_1507, nspC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Carboxynorspermidine decarboxylase
    Species: Campylobacter jejuni subsp. jejuni 81116 [TaxId:407148]
    Gene: carboxynorspermidine decarboxylase, CJJHB9313_1507, nspC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, NSD, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n29A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdhpftmfyekiqtpayileedklrkncel
    lasvgeksgakvllalkgfafsgamkivgeylkgctcsglweakfakeymdkeihtyspa
    fkedeigeiaslshhivfnslaqfhkfqsktqknslglrcnvefslapkelynpcgrysr
    lgirakdfenvdlnaieglhfhalceesadaleavlkvfeekfgkwigqmkwvnfggghh
    itkkgydveklialcknfsdkygvqvylepgeavgwqtgnlvasvvdiienekqiaildt
    sseahmpdtiimpytsevlnarilatrenekisdlkenefaylltgntclagdvmgeyaf
    dkklkigdkivfldqihytivknttfngirlpnlmlldhknelqmirefsykdyslrn
    

    Sequence, based on observed residues (ATOM records):
    >3n29A (A:)
    fyekiqtpayileedklrkncellasvgeksgakvllalkgfafsgamkivgeylkgctc
    sglweakfakeymdkeihtyspafkedeigeiaslshhivfnslaqfhkfqsktqknslg
    lrcnvefsgrysrlgirakdfenvdlnaieglhfhalceesadaleavlkvfeekfgkwi
    gqmkwvnfggghhitkkgydveklialcknfsdkygvqvylepgeavgwqtgnlvasvvd
    iienekqiaildtsseahmpdtiimpytsevlnarilatrenekisdlkenefaylltgn
    tclagdvmgeyafdkklkigdkivfldqihytivknttfngirlpnlmlldhknelqmir
    efsykdyslrn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n29B (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdhpftmfyekiqtpayileedklrkncel
    lasvgeksgakvllalkgfafsgamkivgeylkgctcsglweakfakeymdkeihtyspa
    fkedeigeiaslshhivfnslaqfhkfqsktqknslglrcnvefslapkelynpcgrysr
    lgirakdfenvdlnaieglhfhalceesadaleavlkvfeekfgkwigqmkwvnfggghh
    itkkgydveklialcknfsdkygvqvylepgeavgwqtgnlvasvvdiienekqiaildt
    sseahmpdtiimpytsevlnarilatrenekisdlkenefaylltgntclagdvmgeyaf
    dkklkigdkivfldqihytivknttfngirlpnlmlldhknelqmirefsykdyslrn
    

    Sequence, based on observed residues (ATOM records):
    >3n29B (B:)
    iqtpayileedklrkncellasvgeksgakvllalkgfafsgamkivgeylkgctcsglw
    eakfakeymdkeihtyspafkedeigeiaslshhivfnslaqfhkfqsktqknslglrcn
    vefsgrysrlgirakdfenvdlnaieglhfhalceesadaleavlkvfeekfgkwigqmk
    wvnfggghhitkkgydveklialcknfsdkygvqvylepgeavgwqtgnlvasvvdiien
    ekqiaildtsseahmpdtiimpytsevlnarilatrenekisdlkenefaylltgntcla
    gdvmgeyafdkklkigdkivfldqihytivknttfngirlpnlmlldhknelqmirefsy
    kdyslrn