PDB entry 3n28

View 3n28 on RCSB PDB site
Description: Crystal structure of probable phosphoserine phosphatase from vibrio cholerae, unliganded form
Deposited on 2010-05-17, released 2010-07-14
The last revision was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoserine Phosphatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2345
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM2 (3-End)
      • expression tag (2)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n28A (A:)
    msldalttlpikkhtallnrfpetrfvtqlakkraswivfghyltpaqfedmdfftnrfn
    aildmwkvgryevalmdgeltsehetilkaleldyariqdvpdltkpglivldmdstaiq
    iecideiaklagvgeevaevteramqgeldfeqslrlrvsklkdapeqilsqvretlplm
    pelpelvatlhafgwkvaiasggftyfsdylkeqlsldyaqsntleivsgkltgqvlgev
    vsaqtkadilltlaqqydveihntvavgdgandlvmmaaaglgvayhakpkveakaqtav
    rfaglggvvcilsaalvaqqklswkskeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n28A (A:)
    ldalttlpikkhtallnrfpetrfvtqlakkraswivfghyltpaqfedmdfftnrfnai
    ldmwkvgryevalmdgeltsehetilkaleldyariqdvpdltkpglivldmdstaiqie
    cideiaklagvgeevaevteramqgeldfeqslrlrvsklkdapeqilsqvretlplmpe
    lpelvatlhafgwkvaiasggftyfsdylkeqlsldyaqsntleivsgkltgqvlgevvs
    aqtkadilltlaqqydveihntvavgdgandlvmmaaaglgvayhakpkveakaqtavrf
    aglggvvcilsaalvaqqklswk