PDB entry 3n27

View 3n27 on RCSB PDB site
Description: molecular basis of the inhibition of henipa viruses
Deposited on 2010-05-17, released 2011-06-29
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion glycoprotein F0, linker, Fusion glycoprotein F0
    Species: Hendravirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IH63 (Start-41)
      • linker (47)
    • PDB 3N27 (48-79)
  • Chain 'B':
    Compound: Fusion glycoprotein F0, linker, Fusion glycoprotein F0
    Species: Hendravirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IH63 (Start-41)
      • linker (42-47)
    • PDB 3N27 (48-79)
  • Chain 'C':
    Compound: Fusion glycoprotein F0, linker, Fusion glycoprotein F0
    Species: Hendravirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IH63 (0-End)
    • PDB 3N27 (Start-79)
  • Heterogens: CIT, TBU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n27A (A:)
    amknadninklkssiestneavvklqetaektvyvltalqdysggsggidisielnkaks
    dleeskewirrsnqkldsig
    

    Sequence, based on observed residues (ATOM records):
    >3n27A (A:)
    knadninklkssiestneavvklqetaektvyvltalqdygidisielnkaksdleeske
    wirrsnqkldsig
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n27B (B:)
    amknadninklkssiestneavvklqetaektvyvltalqdysggsggidisielnkaks
    dleeskewirrsnqkldsig
    

    Sequence, based on observed residues (ATOM records):
    >3n27B (B:)
    mknadninklkssiestneavvklqetaektvyvltalqdysggsggidisielnkaksd
    leeskewirrsnqkldsig
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n27C (C:)
    amknadninklkssiestneavvklqetaektvyvltalqdysggsggidisielnkaks
    dleeskewirrsnqkldsig
    

    Sequence, based on observed residues (ATOM records):
    >3n27C (C:)
    amknadninklkssiestneavvklqetaektvyvltaldisielnkaksdleeskewir
    rsnqkldsig