PDB entry 3n26

View 3n26 on RCSB PDB site
Description: Cpn0482 : the arginine binding protein from the periplasm of chlamydia Pneumoniae
Class: transport protein
Keywords: Vaccine development, Alpha and Beta protein (a/b), Structural Genomics, BacAbs - EU FP6 programme, Marseilles Structural Genomics Program @ AFMB, MSGP, TRANSPORT PROTEIN
Deposited on 2010-05-17, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid ABC transporter, periplasmic amino acid-binding protein
    Species: Chlamydophila pneumoniae [TaxId:83558]
    Gene: artJ, CP_0272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n26a_
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n26A (A:)
    mceskidrnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafda
    lilnlkkhridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqhss
    vavqtgtfqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlv
    atrlelppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevayele
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n26A (A:)
    drnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafdalilnlk
    khridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqhssvavqtg
    tfqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlvatrlel
    ppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevay