PDB entry 3n25

View 3n25 on RCSB PDB site
Description: the structure of muscle pyruvate kinase in complex with proline, pyruvate, and mn2+
Deposited on 2010-05-17, released 2010-07-28
The last revision was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'B':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'C':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'D':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'E':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'F':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'G':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Chain 'H':
    Compound: Pyruvate kinase isozymes M1/M2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-530)
      • see remark 999 (29)
      • see remark 999 (400)
      • see remark 999 (403)
  • Heterogens: PRO, MN, PYR, K, NA, GOL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n25A (A:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25A (A:)
    iqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n25B (B:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25B (B:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglelkkgatl
    kitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkflvtevenggfl
    gskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilgekgk
    nikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnragkp
    vicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhliar
    eaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsahqvar
    yrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargff
    kkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n25C (C:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25C (C:)
    iqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtgliaevelkkg
    atlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkdflvteven
    ggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilg
    ekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnr
    agkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqh
    liareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsah
    qvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgka
    rgffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n25D (D:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25D (D:)
    afiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmn
    varmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgta
    evelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgp
    dflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaad
    vhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaq
    kmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdy
    pleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaaliv
    ltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrv
    nlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n25E (E:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25E (E:)
    afiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmn
    varmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgta
    evelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgp
    dflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaad
    vhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaq
    kmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdy
    pleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaaliv
    ltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrv
    nlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n25F (F:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25F (F:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtgliktaevel
    kkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkdflvte
    venggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrk
    ilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigr
    cnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavr
    mqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgr
    sahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnv
    gkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n25G (G:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25G (G:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglevelkkga
    tlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkflvtevengg
    flgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvhevrkilgek
    gknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrcnrag
    kpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrmqhli
    areaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivltesgrsahqv
    aryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkarg
    ffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n25H (H:)
    mskshseagsafiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvet
    lkemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeir
    tglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgl
    islqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmv
    fasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgie
    ipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcim
    lsgetakgdypleavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveas
    ykclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqe
    awaedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records):
    >3n25H (H:)
    fiqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnv
    armnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtae
    velkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarassqstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp