PDB entry 3n24

View 3n24 on RCSB PDB site
Description: The crystal structure of a two-component sensor domain (3rd form) from Pseudomonas aeruginosa PA01
Deposited on 2010-05-17, released 2010-06-02
The last revision was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Sensor protein
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA5484
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n24A (A:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24A (A:)
    eqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvdsa
    eqaaldgvrdaylqlqahtpalndgfseafnglrlrlqdlqqlalagis
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n24B (B:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24B (B:)
    hyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgraeqaaldgvrday
    lqlqahtpdndgfseafnglrlrlqdlqqlalagiseaetsa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3n24C (C:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24C (C:)
    aqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvd
    saeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagisea
    ets
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n24D (D:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24D (D:)
    shhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantaeqaaldg
    vrdaylqlqahtpdndgfseafnglrlrlqdlqqlalagiseaet
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3n24E (E:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24E (E:)
    qeqrmshhyatievsqqlrqllgdqlvillrgqalersqndfrrvleqgrantvdsaeqa
    aldgvrdaylqlqahndgfseafnglrlrlqdlqqlalagis
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3n24F (F:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24F (F:)
    qeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvds
    aeqaaldgvrdaylqlqahtpalndgfseafnglrlrlqdlqqlalagiseaet
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3n24G (G:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24G (G:)
    aqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvd
    saeqaaldgvrdaylqlqahtpalndgfseafnglrlrlqdlqqlalagi
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3n24H (H:)
    snaqeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrant
    vdsaeqaaldgvrdaylqlqahtpalleapmadndgfseafnglrlrlqdlqqlalagis
    eaetsarhra
    

    Sequence, based on observed residues (ATOM records):
    >3n24H (H:)
    qeqrmshhyatievsqqlrqllgdqlvillretpdgqalersqndfrrvleqgrantvds
    aeqaaldgvrdaylqlqahtpadgfseafnglrlrlqdlqqlalagiseae