PDB entry 3n23

View 3n23 on RCSB PDB site
Description: Crystal structure of the high affinity complex between ouabain and the E2P form of the sodium-potassium pump
Deposited on 2010-05-17, released 2011-01-19
The last revision was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 4.6 Å
R-factor: 0.273
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium/potassium-transporting ATPase subunit alpha-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sodium/potassium-transporting ATPase subunit beta-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sodium/potassium-transporting ATPase subunit alpha-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sodium/potassium-transporting ATPase subunit beta-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Na+/K+ ATPase gamma subunit transcript variant a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Na+/K+ ATPase gamma subunit transcript variant a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OBN, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n23A (A:)
    mdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppttpewvk
    fcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgcfsyyqe
    aksskimesfknmvpqqalvirngekmsinaeevvvgdlvevkggdripadlriisangc
    kvdnssltgesepqtrspdftnenpletrniaffstncvegtargivvytgdrtvmgria
    tlasgleggqtpiaaeiehfihiitgvavflgvsffilslileytwleavifligiivan
    vpegllatvtvcltltakrmarknclvknleavetlgststicsdktgtltqnrmtvahm
    wsdnqiheadttenqsgvsfdktsatwlalsriaglcnravfqanqenlpilkravagda
    sesallkcielccgsvkemrerytkiveipfnstnkyqlsihknpntaeprhllvmkgap
    erildrcssilihgkeqpldeelkdafqnaylelgglgervlgfchlflpdeqfpegfqf
    dtddvnfpldnlcfvglismidppraavpdavgkcrsagikvimvtgdhpitakaiakgv
    giisegnetvediaarlnipvsqvnprdakacvvhgsdlkdmtseqlddilkyhteivfa
    rtspqqkliivegcqrqgaivavtgdgvndspaskkadigvamgiagsdvskqaadmill
    ddnfasivtgveegrlifdnlkksiaytltsnipeitpflifiianiplplgtvtilcid
    lgtdmvpaislayeqaesdimkrqprnpktdklvneqlismaygqigmiqalggfftyfv
    ilaengflpihllglrvnwddrwindvedsygqqwtyeqrkiveftchtpffvtivvvqw
    adlvicktrrnsvfqqgmknkilifglfeetalaaflsycpgmgvalrmyplkptwwfca
    fpysllifvydevrkliirrrpggwveketyy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n23B (B:)
    rtggswfkillfyvifygclagifigtiqvmlltisefkptyqdrvappgltqipqsqkt
    eisfrpndpqsyesyvvsivrflekykdlaqkddmifedcgnvpselkergeynnerger
    kvcrfrlewlgncsglndetygykdgkpcviiklnrvlgfkpkppknesletypvmkynp
    yvlpvhctgkrdedkekvgtmeyfglggypgfplqyypyygkllqpkylqplmavqftnl
    tmdteirieckaygenigysekdrfqgrfdvkievks
    

    Sequence, based on observed residues (ATOM records):
    >3n23B (B:)
    rtggswfkillfyvifygclagifigtiqvmlltisefkptyqdrvappgltqipqsqkt
    eisfrpndpqsyesyvvsivrflekykdlaqkddmifedcgnvpselkergeynnerger
    kvcrfrlewlgncgykdgkpcviiklnrvlgfkpkppknesletypvmkynpyvlpvhct
    gkekvgtmeyfglggypgfplqyypyygkllqpkylqplmavqftnltmdteirieckay
    genigysekdrfqgrfdvkievks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3n23C (C:)
    mdelkkevsmddhklsldelhrkygtdlsrgltparaaeilardgpnaltpppttpewvk
    fcrqlfggfsmllwigailcflaygiqaateeepqndnlylgvvlsavviitgcfsyyqe
    aksskimesfknmvpqqalvirngekmsinaeevvvgdlvevkggdripadlriisangc
    kvdnssltgesepqtrspdftnenpletrniaffstncvegtargivvytgdrtvmgria
    tlasgleggqtpiaaeiehfihiitgvavflgvsffilslileytwleavifligiivan
    vpegllatvtvcltltakrmarknclvknleavetlgststicsdktgtltqnrmtvahm
    wsdnqiheadttenqsgvsfdktsatwlalsriaglcnravfqanqenlpilkravagda
    sesallkcielccgsvkemrerytkiveipfnstnkyqlsihknpntaeprhllvmkgap
    erildrcssilihgkeqpldeelkdafqnaylelgglgervlgfchlflpdeqfpegfqf
    dtddvnfpldnlcfvglismidppraavpdavgkcrsagikvimvtgdhpitakaiakgv
    giisegnetvediaarlnipvsqvnprdakacvvhgsdlkdmtseqlddilkyhteivfa
    rtspqqkliivegcqrqgaivavtgdgvndspaskkadigvamgiagsdvskqaadmill
    ddnfasivtgveegrlifdnlkksiaytltsnipeitpflifiianiplplgtvtilcid
    lgtdmvpaislayeqaesdimkrqprnpktdklvneqlismaygqigmiqalggfftyfv
    ilaengflpihllglrvnwddrwindvedsygqqwtyeqrkiveftchtpffvtivvvqw
    adlvicktrrnsvfqqgmknkilifglfeetalaaflsycpgmgvalrmyplkptwwfca
    fpysllifvydevrkliirrrpggwveketyy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3n23D (D:)
    rtggswfkillfyvifygclagifigtiqvmlltisefkptyqdrvappgltqipqsqkt
    eisfrpndpqsyesyvvsivrflekykdlaqkddmifedcgnvpselkergeynnerger
    kvcrfrlewlgncsglndetygykdgkpcviiklnrvlgfkpkppknesletypvmkynp
    yvlpvhctgkrdedkekvgtmeyfglggypgfplqyypyygkllqpkylqplmavqftnl
    tmdteirieckaygenigysekdrfqgrfdvkievks
    

    Sequence, based on observed residues (ATOM records):
    >3n23D (D:)
    rtggswfkillfyvifygclagifigtiqvmlltisefkptyqdrvappgltqipqsqkt
    eisfrpndpqsyesyvvsivrflekykdlaqkddmifedcgnvpselkergeynnerger
    kvcrfrlewlgncgykdgkpcviiklnrvlgfkpkppknesletypvmkynpyvlpvhct
    gkekvgtmeyfglggypgfplqyypyygkllqpkylqplmavqftnltmdteirieckay
    genigysekdrfqgrfdvkievks
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3n23E (E:)
    dpfyydyetvrngglifaalafivgliiils
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >3n23G (G:)
    dpfyydyetvrngglifaalafivgliiils