PDB entry 3n22

View 3n22 on RCSB PDB site
Description: Crystal structure of Ca2+-loaded S100A2
Class: Calcium binding protein
Keywords: EF-hand, Calcium-binding, Zinc-binding, tumor supressor, Calcium binding protein
Deposited on 2010-05-17, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.149
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered mutation (2)
      • engineered mutation (21)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d3n22a_
  • Chain 'B':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered mutation (2)
      • engineered mutation (21)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d3n22b_
  • Heterogens: CA, 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n22A (A:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgspdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n22A (A:)
    sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
    ldensdqqvdfqeyavflalitvmsndf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n22B (B:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgspdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n22B (B:)
    sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
    ldensdqqvdfqeyavflalitvmsndffq