PDB entry 3n21

View 3n21 on RCSB PDB site
Description: Crystal structure of Thermolysin in complex with S-1,2-Propandiol
Class: hydrolase
Keywords: PROTEASE, HYDROLASE, Fragment soaking, METALLOPROTEASE, Metal-binding, Secreted, Zymogen, S-1,2-Propandiol, Fragment based lead discovery
Deposited on 2010-05-17, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n21a_
  • Heterogens: ZN, CA, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n21A (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk