PDB entry 3n1u

View 3n1u on RCSB PDB site
Description: Structure of putative HAD superfamily (subfamily III A) hydrolase from Legionella pneumophila
Class: hydrolase
Keywords: structural genomics, Hydrolase, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2010-05-17, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, HAD superfamily, subfamily III A
    Species: Legionella pneumophila [TaxId:272624]
    Gene: lpg0839
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZX93 (3-182)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3n1ua1, d3n1ua2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n1uA (A:)
    mslnteiemnellekakkikclicdvdgvlsdgllhidnhgnelksfhvqdgmglkllma
    agiqvaiittaqnavvdhrmeqlgithyykgqvdkrsayqhlkktlglnddefayigddl
    pdlpliqqvglgvavsnavpqvlefadwrtertggrgavrelcdlilnaqnkaelaitgy
    lkqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1uA (A:)
    slnteiemnellekakkikclicdvdgvlsdgllhidnhgnelksfhvqdgmglkllmaa
    giqvaiittaqnavvdhrmeqlgithyykgqvdkrsayqhlkktlglnddefayigddlp
    dlpliqqvglgvavsnavpqvlefadwrtertggrgavrelcdlilnaqnkaelaitgyl
    kq