PDB entry 3n1t

View 3n1t on RCSB PDB site
Description: Crystal structure of the H101A mutant ecHint GMP complex
Class: hydrolase
Keywords: histidine triad nucleotide binding protein, Hint, GMP, HYDROLASE
Deposited on 2010-05-17, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIT-like protein hinT
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE7
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3n1ta_
  • Chain 'B':
    Compound: HIT-like protein hinT
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE7
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3n1tb_
  • Chain 'E':
    Compound: HIT-like protein hinT
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE7
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3n1te_
  • Chain 'F':
    Compound: HIT-like protein hinT
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACE7
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3n1tf_
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n1tA (A:)
    maeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheq
    algrmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1tA (A:)
    eetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqal
    grmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n1tB (B:)
    maeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheq
    algrmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1tB (B:)
    aeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqa
    lgrmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3n1tE (E:)
    maeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheq
    algrmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1tE (E:)
    etifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqalg
    rmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n1tF (F:)
    maeetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheq
    algrmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1tF (F:)
    eetifskiirreipsdivyqddlvtafrdispqapthiliipniliptvndvsaeheqal
    grmitvaakiaeqegiaedgyrlimntnrhggqevyhiamhllggrplgpmlahk