PDB entry 3n1m

View 3n1m on RCSB PDB site
Description: Crystal Structure of IhhN bound to BOCFn3
Class: protein binding
Keywords: Binding Sites, Cell Adhesion Molecules, Cell Cycle Proteins, Cell Line, Conserved Sequence, Fibronectins, Hedgehog Proteins, Immunoglobulin G, Membrane Glycoproteins, Membrane Proteins, Protein Binding, Tertiary, Receptors, Cell Surface, Sequence Homology, Signal Transduction, Tumor Suppressor Proteins
Deposited on 2010-05-15, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.166
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Indian hedgehog protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IHH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1mb_
  • Chain 'C':
    Compound: Brother of CDO
    Species: Homo sapiens [TaxId:9606]
    Gene: BOC, UNQ604/PRO1190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1mc_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n1mB (B:)
    gsgpgpgrvvgsrrrpprklvplaykqfspnvpektlgasgryegkiarsserfkeltpn
    ynpdiifkdeentgadrlmtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseesl
    hyegravdittsdrdrnkygllarlaveagfdwvyyeskahvhcsvkse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1mB (B:)
    rpprklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentg
    adrlmtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdr
    drnkygllarlaveagfdwvyyeskahvhcsvkse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n1mC (C:)
    gsterpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkd
    mvegdkywhsishlqpetsydikmqcfneggesefsnvmicetkarkssgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1mC (C:)
    erpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmve
    gdkywhsishlqpetsydikmqcfneggesefsnvmicetkark