PDB entry 3n1l

View 3n1l on RCSB PDB site
Description: Crystal Structure of a StWhy2-rcERE32 complex
Class: DNA binding protein/DNA
Keywords: Single-stranded DNA binding protein, Plant, Whirly, Protein-DNA complex, DNA BINDING PROTEIN-DNA complex
Deposited on 2010-05-15, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein StWhy2
    Species: Solanum tuberosum [TaxId:4113]
    Gene: StWhy2
    Database cross-references and differences (RAF-indexed):
    • PDB 3N1K
    Domains in SCOPe 2.07: d3n1la_
  • Chain 'B':
    Compound: DNA 32-mer rcERE32
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n1lA (A:)
    madagkregrvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvger
    kydwekrqlfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgy
    fislsvvnnnlktndrftvpvttaefavmrtafsfalphimgwdrftnrplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1lA (A:)
    grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
    lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
    nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr
    

  • Chain 'B':
    No sequence available.