PDB entry 3n1h

View 3n1h on RCSB PDB site
Description: Crystal Structure of StWhy2
Class: DNA binding protein
Keywords: StWhy2, Single-stranded DNA binding protein, Plant, Potato, Whirly, DNA BINDING PROTEIN
Deposited on 2010-05-15, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StWhy2
    Species: Solanum tuberosum [TaxId:4113]
    Gene: StWhy2
    Database cross-references and differences (RAF-indexed):
    • PDB 3N1H
    Domains in SCOPe 2.07: d3n1ha_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n1hA (A:)
    madagkregrvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvger
    kydwekrqlfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgy
    fislsvvnnnlktndrftvpvttaefavmrtafsfalphimgwdrftnrplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1hA (A:)
    grvfapysvfkgkaalsaeprlptfnrldsggvklnrrgvimltfwpsvgerkydwekrq
    lfalsatevgslismgtrdsseffhdpsmlssnagqvrkslsikpnadgsgyfislsvvn
    nnlktndrftvpvttaefavmrtafsfalphimgwdrftnr