PDB entry 3n1g

View 3n1g on RCSB PDB site
Description: Crystal structure of DhhN bound to BOCFn3
Class: protein binding
Keywords: Binding Sites, Calcium, Cell Adhesion Molecules, Cell Cycle Proteins, Cell Line, Conserved Sequence, Fibronectins, Hedgehog Proteins, Immunoglobulin G, Membrane Glycoproteins, Membrane Proteins, Protein Binding, Tertiary, Receptors, Cell Surface, Sequence Homology, Signal Transduction, Tumor Suppressor Proteins
Deposited on 2010-05-15, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Desert hedgehog protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DHH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1ga_
  • Chain 'B':
    Compound: Desert hedgehog protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DHH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1gb_
  • Chain 'C':
    Compound: Brother of CDO
    Species: Homo sapiens [TaxId:9606]
    Gene: BOC, UNQ604/PRO1190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1gc_
  • Chain 'D':
    Compound: Brother of CDO
    Species: Homo sapiens [TaxId:9606]
    Gene: BOC, UNQ604/PRO1190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1gd_
  • Heterogens: CA, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n1gA (A:)
    gsgpgpgrgpvgrrryarkqlvpllykqfvpgvpertlgasgpaegrvargserfrdlvp
    nynpdiifkdeensgadrlmterckervnalaiavmnmwpgvrlrvtegwdedghhaqds
    lhyegraldittsdrdrnkygllarlaveagfdwvyyesrnhvhvsvkad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1gA (A:)
    qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
    mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
    ygllarlaveagfdwvyyesrnhvhvsvkad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n1gB (B:)
    gsgpgpgrgpvgrrryarkqlvpllykqfvpgvpertlgasgpaegrvargserfrdlvp
    nynpdiifkdeensgadrlmterckervnalaiavmnmwpgvrlrvtegwdedghhaqds
    lhyegraldittsdrdrnkygllarlaveagfdwvyyesrnhvhvsvkad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1gB (B:)
    qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
    mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
    ygllarlaveagfdwvyyesrnhvhvsvkad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n1gC (C:)
    gsterpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkd
    mvegdkywhsishlqpetsydikmqcfneggesefsnvmicetkarkssgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1gC (C:)
    erpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkdmve
    gdkywhsishlqpetsydikmqcfneggesefsnvmicetkark
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n1gD (D:)
    gsterpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdykkd
    mvegdkywhsishlqpetsydikmqcfneggesefsnvmicetkarkssgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1gD (D:)
    erpvagpyitftdavnettimlkwmyiptpihgfyiyyrptdsdndsdykkdmvegdkyw
    hsishlqpetsydikmqcfneggesefsnvmicetkark